Medical Research Wiki Schema
Domain
Personal medical research knowledgebase focused primarily on ulcerative colitis, with room for related symptoms, comorbidities, interventions, mechanisms, medications, supplements, diet/lifestyle approaches, clinicians, and patient anecdotes.
This wiki is for organizing research and lived-experience reports. It is not medical advice and should support better conversations with clinicians.
Core Principles
- Separate clinical evidence from patient anecdotes and personal notes.
- Preserve raw sources immutably under
raw/; synthesize in wiki pages. - Track provenance for important claims.
- Mark uncertainty, contradictions, and safety concerns explicitly.
- Prefer practical summaries that are readable by a human in Obsidian.
- Every substantial update should add or update links, index entries, and log entries.
Directory Layout
raw/ # Immutable sources
papers/ # PubMed papers, PDFs, preprints
articles/ # Web articles, explainers, blog posts
clinical-guidelines/ # Guidelines from medical societies/hospitals
notion-exports/ # Imported Notion notes/pages
reddit/ # Reddit threads/comments
youtube/ # YouTube transcripts/comments
social/ # X/Twitter, forums, other social sources
personal-notes/ # User-provided notes, symptom logs, observations
conditions/ # Top-level condition objects and condition folders
ulcerative-colitis/ # Example condition object folder
index.md # Main condition hub
research.md # Clinical and mechanistic research map
methods.md # Protocols, diets, supplements, lifestyle methods
coaches-and-influencers.md # Clinicians, coaches, creators, communities
personal-history.md # Paul-specific timeline and observations
symptoms/ # Symptom pages
interventions/ # Diet/lifestyle/protocol/intervention pages
mechanisms/ # Mechanisms, hypotheses, biomarkers
medications-and-supplements/ # Drugs, supplements, dosing discussions
clinicians-and-sources/ # Doctors, researchers, trusted sites, channels
anecdotes/ # Synthesized patient anecdote pages
comparisons/ # Side-by-side analyses
queries/ # Filed answers to substantial questions
journal/ # Chronological research journal and weekly digests
_meta/ # Maps, dashboards, maintenance reports
scripts/ # Local helper scripts, including backupsCondition-First Notebook Model
Paul’s main medical issues should be treated as top-level objects in the notebook. Each major issue should have a condition folder with a main index.md hub plus supporting subpages.
Initial top-level condition objects:
conditions/ulcerative-colitis/conditions/ulcerative-proctitis/if it becomes useful to separate from broader UC.conditions/silent-reflux/conditions/high-cholesterol/conditions/sleep-apnea/- Additional major issues from Guava/Notion as discovered.
Each condition object should answer:
- What is the current understanding of the condition?
- What is Paul’s personal history with it?
- What objective data exists: labs, scopes, imaging, symptom logs, meds tried?
- What healing/cure/remission hypotheses are being tracked?
- Which coaches, clinicians, influencers, or protocols are relevant?
- Which methods/interventions are promising, neutral, or risky?
- What new findings from the journal should be promoted into the organized knowledgebase?
Use the old flat directories (interventions/, mechanisms/, clinicians-and-sources/, anecdotes/) for cross-condition canonical pages, but link them from the condition object pages. Do not let them replace the condition hub structure.
Journal Model
Use journal/ for chronological notes from recurring research, new internet scrubs, and interesting discoveries. The journal is the inbox and narrative layer; the condition pages are the organized knowledgebase.
Recommended paths:
journal/index.md
journal/weekly-digests/YYYY-MM-DD-weekly-medical-research-digest.md
journal/finds/YYYY-MM-DD-short-topic.mdJournal entries should include:
- Date and source type.
- Why it is interesting or hopeful.
- Relevant condition object(s).
- Evidence/anecdote/source class.
- Whether it should be promoted into a condition page, method page, coach/source page, or mechanism page.
- Links to raw sources.
Recurring cron jobs should append or create journal entries first, then promote high-value findings into organized pages when warranted.
Source Classes
Use these source_class values in frontmatter:
Clinical / scientific evidence:
clinical-guidelinesystematic-reviewmeta-analysisrandomized-trialphase-1-trialobservational-studyprospective-cohortcase-control-studycase-seriescase-reportmechanistic-studyanimal-studymechanistic-reviewclinical-reviewreviewhypothesis-paperclinical-guidanceclinical-trial-registry
Clinician / patient / social / provenance:
clinician-articleclinician-videoclinician-emailclinician-voicemailpatient-blogpatient-anecdotepatient-resourcereddit-threadyoutube-transcriptyoutube-commentx-twitter-postforum-threadpersonal-notenotion-importscite-search
Keep this list in sync with tools/validate_structure.py. Run
python3 tools/validate_structure.py after adding pages; add a value here
(and in the validator) before using it, to avoid taxonomy sprawl.
Evidence Levels
Use evidence_level on synthesized pages:
high— multiple guidelines/systematic reviews or strong replicated clinical evidencemoderate— plausible clinical evidence but limitations remainlow— early, indirect, small, uncontrolled, or mostly mechanistic evidenceanecdotal— primarily patient reports/social dataspeculative— hypothesis or weak inferencemixed— conflicting evidence or highly context-dependentunknown— not yet assessed
Confidence Levels
Use confidence separately from evidence level:
high— well supported and consistently representedmedium— useful but incomplete or context-dependentlow— uncertain, sparse, or potentially biased
Safety Fields
When relevant, include:
safety_flags: [requires-clinician, medication-interaction, immunosuppression, pregnancy, liver-risk, kidney-risk, infection-risk, flare-risk, supplement-quality, unknown]
red_flags: []
clinician_questions: []Frontmatter for Synthesized Pages
---
title: Page Title
created: YYYY-MM-DD
updated: YYYY-MM-DD
type: condition | symptom | intervention | mechanism | medication | supplement | clinician-source | anecdote-synthesis | comparison | query | dashboard | care-plan | journal-find | research-digest | weekly-digest
tags: [ulcerative-colitis]
source_class: []
evidence_level: unknown
confidence: medium
sources: []
contested: false
contradictions: []
safety_flags: []
---Frontmatter for Raw Sources
---
title: Source Title
source_url: https://example.com
source_class: patient-anecdote
ingested: YYYY-MM-DD
sha256: BODY_SHA256
notes: []
---Raw sources should not be edited after ingest except to add missing frontmatter. Corrections and synthesis belong in regular wiki pages.
Tag Taxonomy
Core condition tags:
ulcerative-colitisibdflareremissiongut-healthinflammationimmune-systemmicrobiome
Evidence/source tags:
clinical-evidenceguidelinepaperanecdotal-reportssocial-medianotion-importpersonal-note
Intervention tags:
medicationsupplementdietlifestylesleepstressexerciseprotocol
Meta tags:
open-questionneeds-reviewsafetycontradictionclinician-question
Add new tags here before using them to avoid tag sprawl.
Page Thresholds
Create a synthesized page when:
- A condition, symptom, intervention, or mechanism is central to a source.
- An intervention appears in 2+ sources or is important to the user’s situation.
- A recurring anecdotal pattern appears across several reports.
- A query would be painful to re-derive later.
Do not create pages for passing mentions unless they are clinically important or safety-relevant.
Anecdote Handling Rules
Anecdotes are useful but biased. For anecdote pages, track:
- Where the anecdote came from.
- Diagnosis certainty, if available.
- What intervention was tried.
- Dose/duration/timing, if available.
- Reported benefit or harm.
- Confounders: concurrent meds, diet changes, disease severity, placebo/nocebo, selection bias.
- Whether reports cluster around a plausible pattern.
Never present anecdotes as proof. Label them as evidence_level: anecdotal unless corroborated elsewhere.
Medical Research Answer Format
When answering from the wiki, prefer:
Short answer
What the evidence says
What patient anecdotes suggest
Safety / reasons to be cautious
Open questions
Questions to ask a clinician
Sources consultedUpdate Policy
When new information conflicts with existing pages:
- Preserve both claims with dates and sources.
- Prefer clinical guidelines over anecdotes for safety-critical decisions.
- Mark
contested: trueand addcontradictionsif needed. - Add a note to
log.md.
Link Conventions
Internal links use Obsidian [[wikilinks]]. To stay unambiguous under Obsidian’s
default “shortest path when possible” resolver:
- Never use
../relative prefixes. Obsidian wikilinks do not truly resolve them; they only appear to work when a basename happens to be unique. - Unique basename → bare basename. e.g.
[[central-theory]],[[distal-proctitis-onset|Distal / Proctitis-First Onset]]. - Colliding basename → full vault path. There are several
index.mdfiles, so always write[[conditions/ulcerative-colitis/index|Ulcerative Colitis]], never[[index]]or[[../conditions/ulcerative-colitis/index]]. - Give hub pages
aliases:so human-friendly links like[[Ulcerative Colitis]]resolve to the hub, not to an unrelated same-named file. - Run
python3 tools/fix_links.py(dry run) then--applyto normalize links, andpython3 tools/check_links.pyto catch dead/ambiguous/orphan links.
Maintenance
- Read
SCHEMA.md,index.md, and recentlog.mdbefore making updates. - Run
python3 tools/check_links.pyandpython3 tools/validate_structure.pybefore and after structural edits; both exit non-zero on hard errors. - Update
index.mdfor every created synthesized page. - Append every ingestion/query/update to
log.md. - Back up the vault before bulk imports or structural edits.
- Flag stale, low-confidence, and safety-relevant pages for review.